What Is LL-37 and Where Does It Come From?
LL-37 is the only member of the cathelicidin family of antimicrobial peptides found in humans. It represents one branch of the innate immune system — the body's rapid, non-specific first line of defense against invading microbes. Unlike antibodies, which take days to develop, antimicrobial peptides like LL-37 are pre-formed or quickly induced, giving them a central role in immediate host protection.
LL-37 does not exist on its own inside the body. It is stored as part of a larger precursor protein called hCAP-18 (human cationic antimicrobial protein of 18 kDa), which is encoded by the CAMP gene. When needed, enzymes such as proteinase 3 cleave hCAP-18 to release the active C-terminal fragment. The peptide's name comes simply from its structure: it begins with two leucine (L) residues and is 37 amino acids long — hence "LL-37."
The peptide is produced by a wide range of cells and tissues, including neutrophils (a type of white blood cell), epithelial cells lining the skin, gut, and respiratory tract, and cells in sweat, saliva, and other secretions. This broad distribution reflects its role at the body's barrier surfaces, where contact with the outside world — and its microbes — is constant.
Interest in LL-37 has grown as scientists search for alternatives to conventional antibiotics amid rising antimicrobial resistance. Because LL-37 attacks microbes through physical disruption rather than a single molecular target, resistance is thought to develop more slowly. For readers new to this field, our overview of what peptides are provides helpful background before diving into LL-37's specialized biology.
This article is for educational purposes only and does not constitute medical advice.
What Is the Structure of LL-37?
The structure of LL-37 is the key to understanding how it works. Its amino acid sequence is [LL-37, 37 aa], giving it a molecular weight of approximately 4493 g/mol and a molecular formula of C₂₀₅H₃₄₀N₆₀O₅₃. At physiological pH, the peptide carries a net positive charge (it is cationic) because of its many lysine and arginine residues.
LL-37 is also amphipathic, meaning it has distinct regions: one face rich in water-attracting (hydrophilic) residues and another rich in fat-attracting (hydrophobic) residues. In watery environments the peptide is largely unstructured, but when it encounters a lipid membrane — such as the outer surface of a bacterium — it folds into an alpha-helix. This conformational change is essential to its activity.
The combination of positive charge and amphipathic helix explains LL-37's selectivity. Bacterial membranes tend to display negatively charged lipids on their outer surface, so the cationic peptide is electrostatically drawn to microbes rather than to the host's own cells, whose outer membranes are largely neutral. Once bound, the hydrophobic face inserts into the lipid bilayer.
LL-37 can also self-assemble into oligomers, and its behavior is sensitive to salt concentration, pH, and the presence of serum proteins. These environmental factors influence how effective the peptide is in different body compartments — one reason why laboratory results do not always translate directly to living systems. Understanding this structure-function relationship is central to research aimed at designing more stable synthetic analogs.
How Does LL-37 Work as an Antimicrobial Peptide?
The most studied function of LL-37 is direct antimicrobial activity. The peptide is active against a broad spectrum of targets, including Gram-positive and Gram-negative bacteria, certain fungi such as Candida, and some enveloped viruses. This breadth contrasts with many conventional antibiotics that target a narrow range of organisms.
The primary mechanism is membrane disruption. After the cationic peptide binds to the negatively charged microbial surface and folds into its helical form, it accumulates on the membrane. Researchers describe several proposed models for what happens next — including the "carpet" model, in which peptides coat the surface and destabilize it, and pore-forming models, in which peptides insert to create leaky channels. In all cases, the outcome is loss of membrane integrity, leakage of the cell's contents, and microbial death.
Because this attack is physical rather than aimed at a single enzyme or receptor, microbes find it harder to evolve resistance than they do against target-specific drugs. That property has made LL-37 and related antimicrobial peptides a focus of research into new anti-infective strategies. Some studies also report that LL-37 can neutralize lipopolysaccharide (LPS), the pro-inflammatory endotoxin from Gram-negative bacteria, potentially dampening the harmful inflammatory cascade seen in sepsis.
Importantly, LL-37's antimicrobial potency in a test tube can be reduced in the body by physiological salt concentrations and by binding to serum proteins and lipids. This is a recurring theme in antimicrobial peptide research and a major reason clinical translation is challenging. Scientists are exploring modified analogs and delivery systems designed to preserve activity under real-world conditions.
LL-37 is one of many peptides studied for tissue-related and defensive functions; readers interested in the broader landscape can explore our guide to the most-studied peptides.
What Immunomodulatory Roles Does LL-37 Play?
Calling LL-37 simply an "antibiotic peptide" understates its biology. A large body of research shows that LL-37 is also a potent immunomodulator — a molecule that shapes and coordinates the immune response, sometimes at concentrations too low to kill microbes directly.
One well-documented role is chemotaxis: LL-37 attracts immune cells such as neutrophils, monocytes, and T cells to sites of infection or injury, partly through the formyl peptide receptor FPR2. By recruiting these cells, the peptide helps organize a coordinated defense rather than acting alone.
LL-37 also influences how immune cells behave once they arrive. It can modulate the release of cytokines and chemokines — the signaling molecules that regulate inflammation — and can either promote or restrain inflammatory responses depending on context. In some settings it helps clear infection and resolve inflammation; in others, excessive LL-37 can amplify inflammation, a nuance explored later in this guide. The peptide additionally affects the maturation of dendritic cells, which bridge innate and adaptive immunity.
Another notable interaction is with nucleic acids. LL-37 can bind self-DNA and self-RNA released from damaged cells and shuttle them into immune cells, where they can trigger receptors that normally detect microbial genetic material. This mechanism is protective against pathogens but, when dysregulated, contributes to autoimmune signaling — illustrating just how context-dependent LL-37's effects are.
These signaling functions have made LL-37 a model molecule for understanding innate immunity, and they underpin much of the research interest in harnessing or blocking its activity for therapeutic purposes.
Can LL-37 Support Wound Healing and Angiogenesis?
Beyond fighting microbes, LL-37 has attracted attention for its potential role in tissue repair. In wounds, cathelicidin expression rises during the healing process, and preclinical studies suggest the peptide contributes to several stages of repair.
One mechanism is the promotion of re-epithelialization — the migration and proliferation of keratinocytes (skin cells) needed to close a wound. LL-37 has been reported to stimulate keratinocyte migration through pathways involving the epidermal growth factor receptor. Impaired cathelicidin expression, meanwhile, has been observed in chronic, non-healing wounds such as diabetic ulcers, hinting at a functional link.
LL-37 also appears to promote angiogenesis, the formation of new blood vessels. By acting on endothelial cells (which line blood vessels), the peptide can stimulate their proliferation and organization into vessel-like structures in laboratory models. Because adequate blood supply is essential for delivering oxygen and nutrients to healing tissue, this pro-angiogenic effect is of particular interest for wound-repair research.
These properties place LL-37 alongside other peptides studied for regenerative potential, such as BPC-157 and TB-500, though the mechanisms differ substantially and LL-37's evidence base is largely preclinical. It is important to stress that most wound-healing data for LL-37 come from cell cultures and animal models. Robust human clinical evidence establishing safety and efficacy for tissue repair does not yet exist, and no such use is approved by regulators.
What Conditions Is LL-37 Being Researched For?
Given its diverse biology, LL-37 is being investigated across several research areas. It is important to frame these as areas of active investigation rather than established uses — the peptide is not an approved therapy for any condition.
Anti-infective research is the largest field. With antibiotic resistance a growing global concern, LL-37 and engineered analogs are studied as potential new anti-infective agents, sometimes in combination with conventional antibiotics to which they may add synergistic effect. Researchers are also studying LL-37's activity against biofilms — protective microbial communities that resist many standard drugs.
Wound care and dermatology represent a second area, building on the tissue-repair and antimicrobial properties described above, with particular interest in chronic wounds and infected wounds. A third area is inflammatory and immune conditions, where scientists study both boosting LL-37 (to enhance defense) and inhibiting it (to calm harmful inflammation), depending on the disease.
There is also research into LL-37 in the context of cancer biology, where the peptide shows complex, context-dependent effects — appearing to suppress some tumor types while potentially promoting others. This ambiguity underscores that LL-37 is a signaling molecule with pleiotropic effects, not a simple drug candidate.
Because these investigations span preclinical models and early clinical work, readers should be cautious about claims of proven benefits. Anyone considering research peptides should first review our medical disclaimer and consult a qualified healthcare professional. Practical research organization can be supported by tools such as a reconstitution and tracking calculator, but these do not imply endorsement of human use.
Why Can LL-37 Be Both Protective and Harmful?
One of the most important — and often overlooked — aspects of LL-37 biology is that it is dual-edged. The same properties that make it a valuable defender can, in the wrong context, drive disease. Understanding this balance is essential to any honest discussion of the peptide.
In psoriasis, an inflammatory skin condition, LL-37 has been identified as a key player. When LL-37 binds self-DNA and self-RNA released from stressed skin cells, the resulting complexes can activate immune sensors and trigger a self-perpetuating inflammatory loop. Elevated cathelicidin activity is a recognized feature of psoriatic lesions, and LL-37 can even act as an autoantigen — a self-molecule the immune system mistakenly targets.
Similar mechanisms have been implicated in systemic lupus erythematosus and other autoimmune conditions, where LL-37-nucleic acid complexes may help break immune tolerance. In rosacea, abnormal processing of cathelicidin into pro-inflammatory fragments has been linked to the characteristic redness and inflammation. These findings show that too much LL-37, or LL-37 in the wrong place, is not benign.
This duality is precisely why researchers approach therapeutic manipulation of LL-37 cautiously. Strategies to boost the peptide for infection defense must be weighed against the risk of promoting inflammation, and in autoimmune contexts the goal may instead be to block LL-37 activity. It is a clear reminder that no peptide is universally "good" or "bad" — biological effect depends entirely on dose, timing, and physiological context.
What Is the Safety and Regulatory Status of LL-37?
LL-37 is best understood as a research peptide. It is not approved by the FDA, EMA, or other major regulatory agencies for the diagnosis, treatment, or prevention of any disease in humans. Products labeled as LL-37 are generally sold for laboratory research use only, and their legal status varies by jurisdiction.
Human safety data are limited. Because LL-37 is a naturally occurring human peptide, one might assume it is inherently safe, but the dual-role biology described above shows this reasoning is flawed: supraphysiological or mistimed exposure could theoretically promote inflammation or interact with autoimmune processes. As a peptide, LL-37 is also subject to rapid enzymatic degradation in the body, which complicates dosing and delivery and is an active area of pharmaceutical research.
There is currently no established therapeutic dosing protocol for LL-37 in humans, and reputable sources cannot responsibly provide one. Any figures circulating online should be treated with skepticism. Individuals encountering LL-37 in a research or wellness context should recognize that self-administration carries unquantified risks, including immune reactions and unknown long-term effects.
From a regulatory standpoint, peptides in general are increasingly scrutinized: many are classified "for research use only," and authorities have issued warnings about unapproved peptide products. Athletes should also note that immune-modulating and growth-related peptides may fall under anti-doping regulations. For a broader discussion of these considerations, see our resource on peptide terminology and safety concepts.
Medical disclaimer: This guide is provided for educational purposes only. LL-37 is not an approved medicine. Nothing here should be interpreted as encouragement to obtain or use the peptide. Always consult a licensed healthcare professional before making any health-related decision, and be aware that the legal status of research peptides differs from country to country.
Recommended products
Research peptides selected for quality and purity:
GHK-Cu
Anti-Aging Compound
Test your knowledge
Quick quiz · 6 questions
Peptide Lab — free calculator & tracker
Calculate your reconstitution, track your peptides and injections. Free, no credit card required.
Frequently Asked Questions
What is LL-37 and what does its name mean?
How does LL-37 kill bacteria?
Is LL-37 only an antibiotic, or does it do more?
Can LL-37 be harmful?
Is LL-37 approved for medical use?
Sources
- Vandamme D, Landuyt B, Luyten W, Schoofs L. (2012). A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology.
- Dürr UH, Sudheendra US, Ramamoorthy A. (2006). LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochimica et Biophysica Acta.
- Kahlenberg JM, Kaplan MJ. (2013). Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. Journal of Immunology.
- Ramos R, Silva JP, Rodrigues AC, et al. (2011). Wound healing activity of the human antimicrobial peptide LL-37. Peptides.
- Lande R, Gregorio J, Facchinetti V, et al. (2007). Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature.
- Koczulla R, von Degenfeld G, Kupatt C, et al. (2003). An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. Journal of Clinical Investigation.