Press ESC to close

Peptide Lab App Log in Articles Guide Products
More Peptide Tracker Calculator Best Calculators Peptide Statistics Contact Newsletter
Français English Deutsch Español Português العربية Italiano Polski 한국어 日本語 中文 RU
IGF-1
LR3

IGF-1 LR3

Long R3 Insulin-like Growth Factor-1 (Long [Arg3] IGF-I)

≈9,111 g/mol Molecular Weight
No standardized condensed formula (83-residue recombinant polypeptide, C/H/N/O/S) Formula
Research use only. Not approved for human use by the FDA, the EMA or any comparable regulator. Status
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids: a 13-residue N-terminal extension followed by human IGF-1 with Arg substituted for Glu at position 3)
IGF-1 LR3 Photo: George Shervashidze

What is IGF-1 LR3?

IGF-1 LR3, also written Long R3 IGF-1 or Long [Arg3] IGF-I, is a laboratory-engineered analogue of human insulin-like growth factor 1. It is a single non-glycosylated polypeptide chain of 83 amino acids with a molecular mass of approximately 9,111 daltons, produced recombinantly in Escherichia coli. It is not a naturally occurring molecule, and it is not found in any human tissue.

Two deliberate modifications separate it from native IGF-1. First, the glutamic acid at position 3 of the mature IGF-1 sequence is replaced by arginine, which is where the "R3" in the name comes from. Second, a hydrophobic 13-amino-acid extension is fused to the N-terminus; that extension derives from the first residues of methionyl porcine growth hormone, which is where the "Long" comes from. The original family of these fusion analogues was described by Francis and colleagues at the Cooperative Research Centre in Adelaide in 1992, alongside related constructs such as Long IGF-I and Long [Gly3] IGF-I.

The engineering objective was narrow and specific. In circulation, IGF-1 is almost entirely sequestered by a family of six IGF binding proteins (IGFBPs), which restrict how much free growth factor can reach the IGF-1 receptor. Both modifications in IGF-1 LR3 reduce IGFBP affinity substantially, so a given quantity of the analogue produces a stronger receptor-level signal than the same quantity of native IGF-1. Francis and colleagues framed their work precisely this way: comparing analogues in order to establish the relative contribution of IGFBP binding versus receptor binding to biological potency.

What is easy to lose sight of is where this molecule actually lives. IGF-1 LR3 was not developed as a therapeutic candidate and never entered a human development programme. Its commercial identity for three decades has been as a cell culture supplement, sold by reagent suppliers and used in biopharmaceutical manufacturing to sustain mammalian cell lines. Catalogue entries from major protein suppliers list it under research-use-only terms, which is a legal designation, not a formality.

This article is for educational purposes only. IGF-1 LR3 is not approved for human use by the FDA, the EMA or any comparable regulator, and nothing here should be read as guidance for personal use. Consult a qualified healthcare professional for any question about your own health.

How does IGF-1 LR3 differ from native IGF-1 and IGF-1 DES(1-3)?

Native human IGF-1 is a 70-amino-acid single-chain polypeptide of roughly 7.6 kDa, structurally related to proinsulin, produced mainly by the liver under growth hormone control. It is the reference molecule against which every analogue is measured.

IGF-1 DES(1-3), sometimes written des(1-3)IGF-I, takes a subtractive approach. It is IGF-1 with the first three N-terminal residues removed, leaving 67 amino acids. That truncation alone markedly reduces IGFBP-3 binding and increases mitogenic potency in cell systems. DES(1-3) occurs naturally in small quantities in some tissues, which distinguishes it conceptually from the fully synthetic Long R3 construct.

IGF-1 LR3 takes an additive approach: keep the full 70-residue sequence, mutate position 3, and bolt on a 13-residue extension. The result is a larger molecule that achieves a similar goal by a different route.

PropertyNative IGF-1IGF-1 DES(1-3)IGF-1 LR3
Length70 amino acids67 amino acids83 amino acids
Approximate mass≈7.6 kDa≈7.4 kDa≈9.1 kDa
ModificationNone (reference)N-terminal truncationGlu3→Arg plus 13-residue N-terminal extension
IGFBP affinityHighStrongly reducedStrongly reduced
Occurs naturallyYesYes, in trace amountsNo
Human approvalYes, as mecaserminNoNo

Direct head-to-head comparisons exist. Tomas and colleagues compared IGF-1 against long-IGF-I, R3IGF-I, LR3IGF-I and des(1-3)IGF-I in pigs and marmoset monkeys, and reported an acute hypoglycemic potency ranking of IGF-I < long-IGF-I < R3IGF-I ≈ LR3IGF-I < des(1-3)IGF-I. In that work the variants were consistently 2 to 3 times more potent than IGF-1 for lowering plasma glucose to its nadir, and the authors attributed the ranking to relative affinities for the IGFBPs and the IGF-1 receptor.

The practical implication is that IGF-1 LR3 and IGF-1 DES(1-3) are not interchangeable, and neither is a simple "stronger version" of IGF-1. They are distinct molecules with distinct binding profiles, distinct clearance behaviour, and distinct evidence bases, none of which includes controlled human trials.

Where does IGF-1 LR3 sit in the GH/IGF-1 axis?

The growth hormone and IGF-1 axis is a cascade with several layers of control. The hypothalamus releases GHRH and, opposing it, somatostatin. The anterior pituitary responds by secreting growth hormone in pulses. Growth hormone then acts on the liver and other tissues to induce IGF-1 production, and IGF-1 carries out much of what is colloquially attributed to growth hormone itself.

Once in circulation, IGF-1 does not travel free. The FDA prescribing information for recombinant IGF-1 states that more than 80% of circulating IGF-1 is bound as a complex with IGFBP-3 and an acid-labile subunit, forming a ternary complex of roughly 150 kDa. That complex functions as a reservoir: it protects IGF-1 from rapid degradation, restricts its access to receptors, and buffers the system against sharp swings. The same document notes that IGF-1 clearance is inversely proportional to IGFBP-3 levels, which is a direct statement of how much the binding proteins govern the pharmacokinetics.

IGF-1 LR3 was designed to bypass precisely this layer. By binding IGFBPs poorly, it does not enter the ternary complex in the normal way and therefore does not benefit from the reservoir effect. It also participates in feedback. IGF-1 exerts negative feedback on pituitary GH secretion, and an analogue that reaches the receptor more readily can suppress the axis it sits inside. Dunaiski and colleagues infused Long [R3] IGF-I into pigs for four days at 180 micrograms per kilogram per day and reported a 23% decrease in mean plasma GH concentration, a 60% reduction in the area under the GH peaks, and reduced plasma IGFBP-3, endogenous IGF-1 and insulin. Average daily gain and food intake also fell.

This is the structural reason IGF-1 LR3 belongs to a different category than the growth hormone secretagogues. Compounds such as CJC-1295, ipamorelin, tesamorelin and GHRP-2 act upstream, at the hypothalamic or pituitary level, and depend on the pituitary's own capacity to release growth hormone. Whatever they do, they operate within the axis and remain subject to its negative feedback. IGF-1 LR3 acts downstream of the pituitary entirely, at the receptor, which is why its effects on the axis can be suppressive rather than stimulatory.

For readers mapping the landscape, that distinction matters more than any potency comparison. A secretagogue and a receptor-level agonist are not two grades of the same intervention. They are different mechanisms with different feedback consequences.

How is IGF-1 LR3 different from mecasermin, the approved IGF-1 drug?

This is the single most important distinction in the whole subject, and it is routinely blurred.

Mecasermin, marketed as Increlex, is recombinant human IGF-1. Its amino acid sequence is identical to endogenous human IGF-1. It received initial US approval in 2005 and is indicated for the long-term treatment of growth failure in pediatric patients with severe primary IGF-1 deficiency, and in patients with growth hormone gene deletion who have developed neutralizing antibodies to growth hormone. It has a prescribing information document, a defined indication, a boxed set of warnings, a pharmacovigilance record and a global patient registry.

IGF-1 LR3 has none of that. It is a structurally different molecule, it has no approved indication in any jurisdiction, it has no prescribing information, and it has no clinical safety database. The fact that mecasermin is approved tells you that regulators accept recombinant IGF-1 for one narrow pediatric population under specialist supervision. It tells you nothing at all about IGF-1 LR3.

The pharmacokinetic profile of mecasermin is worth knowing, because it is the only human-derived anchor in this whole area. According to the FDA label, subcutaneous bioavailability in healthy subjects is estimated to be close to 100%, IGF-1 is metabolized by both liver and kidney, and the mean terminal half-life after a single subcutaneous administration in pediatric subjects with severe primary IGF-1 deficiency is estimated at 5.8 hours. The label also notes that IGFBP-3 is greatly reduced in severe primary IGF-1 deficiency, which increases IGF-1 clearance in these patients relative to healthy subjects.

That last detail is directly relevant to any reasoning about IGF-1 LR3. Reduced IGFBP binding is associated with faster clearance, not slower. An analogue engineered to avoid IGFBPs is, by the same logic, giving up the protection those proteins provide.

A separate point about safety framing: because mecasermin has been used under medical supervision for two decades, its adverse event profile is documented in a way that IGF-1 LR3's simply is not. When people cite the safety of "IGF-1 therapy", they are usually citing mecasermin data, generated in a supervised pediatric population with a specific deficiency, and applying it to a different molecule used without supervision. That is not a valid transfer.

What do the cell and animal studies actually show?

The published record on IGF-1 LR3 falls into two clean categories: cell culture work, which is substantial and consistent, and animal work, which is real but considerably more ambiguous than promotional summaries suggest. There is no category three. Controlled human trials of IGF-1 LR3 do not exist.

Cell culture. This is where the molecule has genuine established utility. Long R3 IGF-I is widely used in serum-free Chinese hamster ovary (CHO) cell culture as a substitute for insulin, because it sustains cell viability and recombinant protein production at far lower concentrations than insulin requires. Work published in Biologicals by Qian and colleagues in an industrial CHO cell line found that LR3 improved protein productivity and also altered product quality: the recombinant Fc-fusion protein had higher sialic acid content and a lower percentage of asialylated N-linked glycans, an effect the authors traced to decreased Neu2 sialidase expression in response to LR3. This is the application that keeps the molecule in commercial production.

Animal studies. Here the picture requires care. Tomas and colleagues studied IGF-1 and two low-IGFBP-affinity variants, des(1-3)IGF-I and LR3-IGF-I, in streptozotocin-diabetic rats and reported dose-dependent increases in growth rate and nitrogen balance, with the two variants proving 2.5 to 3 times more potent than IGF-1 at restoring growth. Crucially, the same paper concluded that other insulin-dependent metabolic processes in liver, muscle and adipose tissue were not restored. Growth recovery and metabolic normalization came apart.

A later study by Tomas examined infused LR(3)IGF-I during food restriction and found that treated rats maintained higher body weight and nitrogen retention than vehicle-infused animals, but that muscle protein specifically was not conserved. Conlon and colleagues infused LR3IGF-I into guinea pigs for seven days and found that the fractional weights of adrenals, gut, kidneys and spleen were significantly increased while overall growth was not stimulated; plasma IGF-1 and IGF-2 concentrations both fell, apparently secondary to reduced total IGFBP, especially IGFBP-3. And as noted above, Dunaiski and colleagues found reduced average daily gain and food intake in pigs.

Read together, these do not describe a clean anabolic agent. They describe a molecule that reliably engages the IGF-1 receptor, that can improve certain whole-body nitrogen and weight endpoints in catabolic models, that can preferentially enlarge visceral organs rather than skeletal muscle, and that suppresses the endogenous axis. Anyone reading claims about muscle growth should hold that alongside the broader evidence discussed in our overview of peptides for muscle growth and recovery and the mechanistic contrasts drawn in peptides versus steroids.

Preclinical findings in rats, pigs and guinea pigs do not establish efficacy or safety in humans. Species differences in IGFBP profiles alone are substantial enough to complicate extrapolation.

How long does IGF-1 LR3 persist in the body?

This section has to begin with what cannot be said. There is no published human pharmacokinetic study of IGF-1 LR3 that establishes a half-life figure. Specific numbers are widely quoted on vendor and forum pages, most commonly a range in the region of twenty to thirty hours. We have been unable to trace any of those figures to a primary human study, and we will not reproduce a number whose source cannot be checked. An unsourced pharmacokinetic value that gets repeated enough times starts to look like a fact, and in this case it is not one.

What can be said is mechanistic, and it points in an unexpected direction. The IGFBP-3 and acid-labile subunit ternary complex is what gives circulating IGF-1 its extended residence time. Free IGF-1 is cleared quickly; complexed IGF-1 is not. An analogue engineered to escape IGFBP binding has, by construction, forfeited the reservoir that prolongs IGF-1's presence in plasma.

The animal literature is consistent with this. Tomas and colleagues, comparing hypoglycemic action across IGF-1 variants in pigs and marmoset monkeys, described the variants as showing "more rapid clearance from the circulation" while nonetheless producing proportionately superior sustained hypoglycemic action. In other words, faster clearance coexisted with stronger and longer-lasting effect, because the two are governed by different things: clearance by binding protein association, effect duration by receptor engagement and downstream signaling.

The closest human anchor remains mecasermin, whose mean terminal half-life is estimated at 5.8 hours in the pediatric population studied, with clearance explicitly described as inversely proportional to IGFBP-3 concentration. That figure belongs to a different molecule and a specific patient group, so it should be read as context rather than as a substitute value for IGF-1 LR3.

Readers who arrived here looking for the practical arithmetic side of this compound rather than the pharmacology will find that in our IGF-1 LR3 calculator.

What risks are discussed in the literature?

Three categories of concern appear repeatedly in the peer-reviewed literature. They are presented here descriptively, with their evidentiary limits stated, because the honest position on several of them is uncertainty rather than reassurance.

Hypoglycemia. This is the best-characterized acute hazard and the one with the clearest mechanistic basis. IGF-1 and insulin receptors are structurally homologous, IGF-1 has genuine insulin-like metabolic activity, and analogues that evade IGFBPs deliver more free ligand to those receptors. Tomas and colleagues measured exactly this: acute hypoglycemic potency in pigs and marmoset monkeys was 2 to 3 times higher for the low-IGFBP-affinity variants than for IGF-1. On the human side, the FDA label for mecasermin reports that in clinical studies of 71 subjects with primary IGF-1 deficiency treated for a mean of 3.9 years, hypoglycemia was reported by 30 subjects (42%) at least once; most episodes were mild or moderate, but 5 subjects had severe hypoglycemia requiring assistance on one or more occasion, and 4 experienced hypoglycemic seizures or loss of consciousness. That is supervised use of an approved product with an indication.

Proliferative signaling and the cancer question. The IGF-1 receptor is a mitogenic receptor. It is expressed across a wide range of tumors, IGF-1R signaling contributes to malignant cell survival and transformation, and the pathway has been a sustained target for oncology drug development, as reviewed by Guven and colleagues in 2025. Separately, Renehan and colleagues published a systematic review and meta-regression in The Lancet in 2004 finding that high concentrations of circulating IGF-1 were associated with increased risk of prostate cancer and premenopausal breast cancer. Two qualifications are essential. That analysis concerned endogenous circulating IGF-1 in observational cohorts, so it describes association and not causation. And no study has evaluated whether administering IGF-1 LR3 changes cancer incidence in humans; the question has not been asked, which is different from having been answered reassuringly.

Axis suppression and disproportionate tissue effects. The animal work already described found suppressed growth hormone secretion, reduced endogenous IGF-1 and IGFBP-3, and in guinea pigs selective enlargement of adrenals, gut, kidneys and spleen without overall growth stimulation. Organ-level effects that do not track with intended outcomes are a recognized signal worth taking seriously.

A fourth, non-pharmacological risk deserves mention: material sold as research-grade is not manufactured to pharmaceutical standards, and identity, purity, endotoxin content and sterility are not verified by any regulator. The general framework for thinking about this is covered in our discussion of whether peptides are safe.

This section is educational and is not a safety assessment for personal use. IGF-1 LR3 is not approved for human use. Anyone with a question about IGF-1 physiology in their own case should raise it with a qualified healthcare professional.

What is the status of IGF-1 LR3 in sport and regulation?

The anti-doping position is unambiguous and worth stating precisely, since the exact class is often misreported.

IGF-1 and its analogues fall under section S2 of the WADA Prohibited List, "Peptide Hormones, Growth Factors, Related Substances and Mimetics", and specifically within subsection S2.3, covering growth factors and growth factor modulators. That subsection names insulin-like growth factor 1 and its analogues alongside mechano growth factors, fibroblast growth factors, hepatocyte growth factor, platelet-derived growth factor, thymosin-β4 and its derivatives, and vascular endothelial growth factor. It also contains a catch-all for other growth factors affecting muscle, tendon or ligament protein synthesis or degradation, vascularisation, energy utilization, regenerative capacity or fibre type switching.

Two features of that listing matter operationally. Substances in S2 are prohibited at all times, meaning both in-competition and out-of-competition, so there is no window in which use is permissible. And S2 substances are classified as non-specified, which places an anti-doping rule violation at the strictest end of the sanctioning framework. Because IGF-1 LR3 is explicitly an IGF-1 analogue, it is squarely within scope; there is no argument available that a modified sequence sits outside the class.

Detection is an active technical field rather than a solved problem. Bailes and Soloviev reviewed IGF-1 monitoring across both medical diagnostics and sport in Biomolecules in 2021, covering the analytical challenges of distinguishing administered material from endogenous production and the role of IGFBP profiles in interpretation. Athletes should assume analytical capability improves rather than stagnates.

On the broader regulatory side, the position is simpler than it sounds. IGF-1 LR3 has no marketing authorization anywhere. It is sold under research-use-only terms, a designation that restricts it to laboratory application and explicitly excludes human or diagnostic use. Regulators including the FDA have issued warning letters to companies marketing unapproved peptide products for human use. Legal status for possession and import varies by jurisdiction and changes, so local rules should be checked directly rather than inferred.

What remains unknown about IGF-1 LR3?

Being explicit about the gaps is more useful than filling them with confident-sounding approximations. The following are genuinely open.

Human pharmacokinetics. No published study establishes absorption, distribution, metabolism, clearance or half-life for IGF-1 LR3 in humans. The figures in circulation are not traceable to primary data. Until a study exists, the correct answer to "how long does it last" is that nobody has measured it and published the result.

Human exposure-response relationships. Because there are no human trials, there is no characterized relationship between systemic exposure and any outcome, favourable or adverse. The point at which hypoglycemia becomes likely in humans is unknown. So is the point at which axis suppression becomes meaningful.

Long-term consequences. Chronic effects on glucose handling, on the endogenous GH/IGF-1 axis after withdrawal, on organ proportion, and on neoplastic risk are all unstudied for this molecule. The Renehan association data concern endogenous IGF-1 and cannot be extended to an administered analogue without new evidence.

Translational validity of the animal work. Rats, pigs, guinea pigs and marmosets differ from humans in IGFBP composition and in axis regulation. Given that the entire point of IGF-1 LR3 is manipulating IGFBP interaction, species differences in those very proteins are a particularly awkward source of uncertainty. The divergent results across species in the existing literature, growth restored in diabetic rats, growth suppressed in pigs, organ enlargement without growth in guinea pigs, illustrate the problem directly.

Product identity. Because research-grade material is outside pharmaceutical quality systems, the contents of a given vial are not independently verified. Two vials labelled identically are not guaranteed to be the same thing.

Taken together, the honest summary is that IGF-1 LR3 is a well-characterized laboratory reagent and an uncharacterized human exposure. Those two statements sit comfortably side by side, and conflating them is the most common error in writing about this compound.

Test your knowledge

Quick quiz · 6 questions

🧪

Peptide Lab: free calculator & tracker

Calculate your reconstitution, track your peptides and injections. Free, no credit card required.

Discover Peptide Lab →

Frequently Asked Questions

Is IGF-1 LR3 approved for human use anywhere?
No. IGF-1 LR3 has no marketing authorization from the FDA, the EMA or any comparable regulator, in any indication, in any country. It is supplied under research-use-only terms, a designation that restricts it to laboratory application. Its principal legitimate use is as a supplement in mammalian cell culture, particularly in industrial CHO bioprocessing.
Is IGF-1 LR3 the same thing as mecasermin?
No, and the distinction is important. Mecasermin (Increlex) is recombinant human IGF-1 with a sequence identical to the endogenous hormone. It received initial US approval in 2005 for growth failure in pediatric patients with severe primary IGF-1 deficiency. IGF-1 LR3 is a different molecule: 83 amino acids rather than 70, with arginine at position 3 and a 13-residue N-terminal extension. Safety and efficacy data generated for mecasermin do not transfer to IGF-1 LR3.
How long does IGF-1 LR3 stay in the body?
There is no published human pharmacokinetic study of IGF-1 LR3, so no verified half-life figure exists. Specific numbers quoted on vendor pages cannot be traced to primary data and should not be treated as established. Mechanistically, reduced IGFBP binding is associated with faster clearance rather than slower, because the IGFBP-3 and acid-labile subunit complex is what normally extends IGF-1's residence time in plasma. For reference, mecasermin has a mean terminal half-life estimated at 5.8 hours in the pediatric population studied, but that is a different molecule.
What is the difference between IGF-1 LR3 and IGF-1 DES(1-3)?
Both are IGF-1 variants engineered to bind the IGF binding proteins poorly, but by opposite strategies. IGF-1 DES(1-3) removes the first three N-terminal amino acids, leaving 67 residues. IGF-1 LR3 keeps the full sequence, substitutes arginine for glutamic acid at position 3, and adds a 13-residue N-terminal extension, giving 83 residues. In comparative animal work, acute hypoglycemic potency ranked IGF-I below long-IGF-I, below R3IGF-I and LR3IGF-I, below des(1-3)IGF-I. Neither analogue has any human approval.
Does IGF-1 LR3 build muscle?
The published animal evidence does not support a simple yes. In diabetic rats, low-IGFBP-affinity variants restored growth 2.5 to 3 times more potently than IGF-1, but other insulin-dependent metabolic processes in liver, muscle and adipose tissue were not restored. In a food restriction model, LR(3)IGF-I maintained higher body weight and nitrogen retention but muscle protein specifically was not conserved. In guinea pigs, it increased the fractional weight of adrenals, gut, kidneys and spleen without stimulating overall growth. In pigs, average daily gain and food intake fell. There are no human trials.
Is IGF-1 LR3 banned in sport?
Yes. IGF-1 and its analogues are listed under WADA class S2.3, covering growth factors and growth factor modulators, within section S2 of the Prohibited List. Substances in S2 are prohibited at all times, in-competition and out-of-competition, and are classified as non-specified, which carries the strictest sanctioning framework. Because IGF-1 LR3 is explicitly an IGF-1 analogue, it falls directly within the listed class.
Does IGF-1 LR3 cause cancer?
No study has tested this question in humans, so it cannot be answered either way. What is established is that the IGF-1 receptor is a mitogenic receptor expressed across many tumor types and an active oncology drug target, and that a 2004 systematic review and meta-regression in The Lancet found high concentrations of circulating endogenous IGF-1 associated with increased risk of prostate cancer and premenopausal breast cancer. Those are observational associations concerning naturally produced IGF-1, not evidence about an administered analogue. The absence of evidence here is a genuine gap rather than a clean bill of health.
Why is IGF-1 LR3 mostly sold as a cell culture reagent?
Because that is what it was developed to do well. Its weak IGFBP binding makes it a more potent stimulus than insulin in serum-free mammalian cell culture, effective at far lower concentrations, which makes it cost-efficient at industrial scale. Published work in an industrial CHO cell line found that it improved protein productivity and also increased sialic acid content in the recombinant product, an effect linked to decreased Neu2 sialidase expression. That bioprocessing role, not any therapeutic programme, is what has kept the molecule in commercial production for three decades.

Sources

  1. Francis GL, et al. (1992). Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. Journal of Molecular Endocrinology.
  2. Tomas FM, et al. (1993). Insulin-like growth factor-I and more potent variants restore growth of diabetic rats without inducing all characteristic insulin effects. Biochemical Journal.
  3. Conlon MA, Tomas FM, Owens PC, Wallace JC, Howarth GS, Ballard FJ (1995). Long R3 insulin-like growth factor-I (IGF-I) infusion stimulates organ growth but reduces plasma IGF-I, IGF-II and IGF binding protein concentrations in the guinea pig. Journal of Endocrinology.
  4. Tomas FM, Walton PE, Dunshea FR, Ballard FJ (1997). IGF-I variants which bind poorly to IGF-binding proteins show more potent and prolonged hypoglycaemic action than native IGF-I in pigs and marmoset monkeys. Journal of Endocrinology.
  5. Dunaiski V, Dunshea FR, Walton PE, Goddard C (1997). Long [R3] insulin-like growth factor-I reduces growth, plasma growth hormone, IGF binding protein-3 and endogenous IGF-I concentrations in pigs. Journal of Endocrinology.
  6. Tomas FM (2001). Insulin-like growth factor-I (IGF-I) analogue, LR(3)IGF-I, ameliorates the loss of body weight but not of skeletal muscle during food restriction. Growth Hormone & IGF Research.
  7. Renehan AG, Zwahlen M, Minder C, O'Dwyer ST, Shalet SM, Egger M (2004). Insulin-like growth factor (IGF)-I, IGF binding protein-3, and cancer risk: systematic review and meta-regression analysis. The Lancet.
  8. Guven DC, Ahmed J, Stephen B, Naing A (2025). IGF-1R inhibitors in cancer: A review of available evidence and future outlook. Critical Reviews in Oncology/Hematology.
  9. Bailes J, Soloviev M (2021). Insulin-Like Growth Factor-1 (IGF-1) and Its Monitoring in Medical Diagnostic and in Sports. Biomolecules.
  10. Qian Y, Lewis AM, Sidnam SM, Bergeron A, Abu-Absi NR, Vaidyanathan N, Deresienski A, Qian NX, Borys MC, Li ZJ (2016). LongR3 enhances Fc-fusion protein N-linked glycosylation while improving protein productivity in an industrial CHO cell line. Biologicals.
  11. U.S. Food and Drug Administration (2019). INCRELEX (mecasermin) injection, for subcutaneous use: full prescribing information. FDA Drug Label.
  12. World Anti-Doping Agency (2026). The Prohibited List, section S2: Peptide Hormones, Growth Factors, Related Substances and Mimetics. WADA.

This content is for informational and educational purposes only. It does not constitute medical advice. Consult a healthcare professional before making any decisions. Read our full medical disclaimer

GHK-Cu
GHK-Cu
Powerful Anti-Aging →